Aquicella siphonis: AQUSIP_04050 Help Entry AQUSIP_04050      CDS       T06267                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism asip  Aquicella siphonis Pathway asip02024   Quorum sensing asip03018   RNA degradation Brite KEGG Orthology (KO) [BR:asip00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AQUSIP_04050 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AQUSIP_04050 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:asip03019]     AQUSIP_04050 (hfq)    03036 Chromosome and associated proteins [BR:asip03036]     AQUSIP_04050 (hfq) Messenger RNA biogenesis [BR:asip03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AQUSIP_04050 (hfq) Chromosome and associated proteins [BR:asip03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AQUSIP_04050 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  VVC75129 UniProt:  A0A5E4PDU3 LinkDB All DBs Position 1:430595..430900 Genome browser AA seq 101 aa AA seqDB search MTKGPSLQDPFLNSLRKEKIPVSIYLVNGIKLQGVIESFDQFVVLLKNTVSQMVYKHAIS TIVPARNVSSPFEYTTGGFNTNGNGNKNNGNSSKSNLPPHE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaggaccatcattacaagatcctttcctgaactctttgcgcaaggaaaaaatc cctgtttctatctatttggtaaacggaatcaaactccagggagtgattgagtcgtttgat caatttgtggttttgttgaaaaacaccgtcagccagatggtgtataagcacgcgatttcc actattgtgccggcgcgcaacgtgtcttcaccctttgaatatacgaccggcgggtttaac accaatggtaatggaaataaaaacaatggcaatagcagcaaatctaacttgccgccccat gaatag

DBGET integrated database retrieval system