Alligator sinensis (Chinese alligator): 102367775 Help Entry 102367775         CDS       T02922                                  Name (RefSeq) histone H2A.J-like   KO K11251   histone H2A Organism asn  Alligator sinensis (Chinese alligator) Pathway asn03082   ATP-dependent chromatin remodeling asn04217   Necroptosis Brite KEGG Orthology (KO) [BR:asn00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102367775  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102367775  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:asn03036]     102367775   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102367775 Chromosome and associated proteins [BR:asn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102367775 Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102367775 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102367775 NCBI-ProteinID:  XP_006024251 UniProt:  A0A1U7RQP8 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TERAKTK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccgcggcaagcagggcgggaaggcgcgggccaaggccaagtctcgctcctcg cgggctgggctgcagttcccggtgggccgcgtgcaccgcctcctgcgcaagggccactac gcggagcgggtcggagccggggccccggtctacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcgcgggacaacaagaagacgcgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagggccaagaccaagtaa

DBGET integrated database retrieval system