Alligator sinensis (Chinese alligator): 102368350 Help Entry 102368350         CDS       T02922                                  Symbol GNRH2 Name (RefSeq) progonadoliberin-2   KO K05252   gonadotropin-releasing hormone Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04080   Neuroactive ligand-receptor interaction asn04081   Hormone signaling asn04912   GnRH signaling pathway Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102368350 (GNRH2)    04081 Hormone signaling     102368350 (GNRH2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     102368350 (GNRH2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asn04052]     102368350 (GNRH2) Cytokines and neuropeptides [BR:asn04052]  Neuropeptides   GPCR binding    102368350 (GNRH2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GnRH Motif Other DBs NCBI-GeneID:  102368350 NCBI-ProteinID:  XP_006020952 UniProt:  A0A1U7RMU3 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MACPRSLLLLLVLLLAIGVPLARAQHWSHGWYPGGKRELDLSQAPQASEEIKICGGEECA YVRSPRMNVVKTLLADMLARQLQKKK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcatgcccgaggtccctcctgctcctgcttgtcctcctgttggccatcggcgtgccc ctggcacgagcccagcactggtcccacggctggtaccccggcgggaagagggagctggac ttgtcgcaggcaccacaggcttcagaagaaatcaagatctgtggcggggaagagtgcgct tacgtgaggagcccaaggatgaacgttgtgaagaccctgctggctgacatgctggcacgg cagctgcagaagaagaagtga

DBGET integrated database retrieval system