Alligator sinensis (Chinese alligator): 102368943 Help Entry 102368943         CDS       T02922                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04144   Endocytosis asn04510   Focal adhesion asn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:asn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102368943 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102368943 (CAV1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102368943 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102368943 (CAV1) Membrane trafficking [BR:asn04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102368943 (CAV1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102368943 NCBI-ProteinID:  XP_025059944 UniProt:  A0A3Q0GJR4 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search GPGRAGPGPVLDTDQIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLAAIFGIP LALIWGIYFAILSFLHIWAVVPCIRSYLIEIQCISRVYSICIHTFCDPLFEAIGKIFSSI QATVRKEI NT seq 387 nt NT seq  +upstreamnt  +downstreamnt gggccgggccgggccgggccgggccctgtgttggacacagatcagattgattttgaagat gtgattgccgaaccagagggaacacacagttttgacgggatctggaaagctagcttcacc accttcactgtgacaaaatactggttttatcgcttactggcagcaatctttggcattcct ttggctctcatttggggtatttactttgccattttgtcattcctgcacatctgggcagtg gtgccttgtataaggagctacctgattgagatccagtgcattagccgggtctattctatc tgcatccacaccttctgtgacccactatttgaggccatcggcaaaatatttagctcaatt caagcaacagtacggaaagaaatataa

DBGET integrated database retrieval system