Alligator sinensis (Chinese alligator): 102370005 Help Entry 102370005         CDS       T02922                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04140   Autophagy - animal asn04144   Endocytosis asn04530   Tight junction Brite KEGG Orthology (KO) [BR:asn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102370005 (RAB8A)    04140 Autophagy - animal     102370005 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102370005 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102370005 (RAB8A)    03036 Chromosome and associated proteins [BR:asn03036]     102370005 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102370005 (RAB8A)    04031 GTP-binding proteins [BR:asn04031]     102370005 (RAB8A) Membrane trafficking [BR:asn04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102370005 (RAB8A)  Autophagy   Other autophagy associated proteins     102370005 (RAB8A) Chromosome and associated proteins [BR:asn03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102370005 (RAB8A) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102370005 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102370005 (RAB8A)   Exosomal proteins of colorectal cancer cells    102370005 (RAB8A) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102370005 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA DUF3963 Motif Other DBs NCBI-GeneID:  102370005 NCBI-ProteinID:  XP_025066119 UniProt:  A0A3Q0H266 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MVRLERGRARPLRRYSHCGSPPGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYR GAMGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKL AASFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKS SFFRCVLL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggtgcggctggaaaggggcagggcccggcccctgcgcaggtactcacactgcggctcc cccccaggcatcgacttcaaaatcagaaccatcgagctggaggggaagaggatcaagctg cagatctgggacactgccggccaggagcggttccgaacgatcaccacggcctactacaga ggagccatgggcatcatgttagtgtatgacatcaccaatgaaaaatcatttgaaaatatt cggaattgggtccggaatatcgaagagcatgcatccccagatgttgaaaagatgattctt ggaaacaaatgtgatgcaaatgacaaaagacaggtttccagagagcaaggagagaagctt gctgccagttttggaattaagttcatggaaaccagcgcaaaagcaaatattaatatagaa aatgcttttttcactcttgcaagagatatcaaagcaaaaatggacaagaaattggaaggc aatagcccacaaggcagcaaccagggagtcaaaatcactccagaccaacaaaagaaaagc agctttttccgatgtgttcttctgtga

DBGET integrated database retrieval system