Alligator sinensis (Chinese alligator): 102370363 Help Entry 102370363         CDS       T02922                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism asn  Alligator sinensis (Chinese alligator) Pathway asn03272   Virion - Hepatitis viruses asn04382   Cornified envelope formation asn04514   Cell adhesion molecule (CAM) interaction asn04530   Tight junction Brite KEGG Orthology (KO) [BR:asn00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102370363 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102370363 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102370363 (CLDN7)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102370363 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:asn03037]     102370363 (CLDN7)    04147 Exosome [BR:asn04147]     102370363 (CLDN7) Cilium and associated proteins [BR:asn03037]  Other cilia and associated proteins   Stereociliary proteins    102370363 (CLDN7) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102370363 (CLDN7)   Exosomal proteins of colorectal cancer cells    102370363 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Trp_oprn_chp DUF7847 DUF6677 DUF6232 CdpA_N Motif Other DBs NCBI-GeneID:  102370363 NCBI-ProteinID:  XP_006037385 UniProt:  A0A1U7SGK1 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MGRGSEPRGVGSPVASAPPHPSPPCSPASLQATRALMVVAVVLGLVALGIAIMGMKCTRC GGDNKVQKARIAMTGGLVYVVAGLAGLVACSWYGHQIVTDFYNPLVPMNAKYEFGSGIFV GWAGSALTLLGGGLLSCSCPGKSGPRAQYPKSKAASSNREYV NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggcgggggtcagaacccaggggggttgggagcccagttgcctcggctccccctcac ccttcccctccctgctccccagcctccctgcaggccacacgggcattgatggtggtggca gtggtgctgggactggtggcactgggcattgccatcatgggcatgaagtgtacacgctgc ggcggcgacaacaaggtgcagaaggcacgcattgccatgacgggcggcctcgtctacgtg gtggctggcttggctgggcttgtggcctgctcctggtacgggcatcagatcgtcaccgac ttctacaaccccttagtgcccatgaatgccaagtacgagtttgggtcgggcatcttcgtg ggctgggctggctccgccctgactctcctgggtggggggctgctctcctgctcctgccct gggaagtcaggaccccgggcgcagtatcccaagagcaaggcggcctccagcaaccgcgaa tatgtctag

DBGET integrated database retrieval system