Alligator sinensis (Chinese alligator): 102371333 Help Entry 102371333         CDS       T02922                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04144   Endocytosis Brite KEGG Orthology (KO) [BR:asn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102371333 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102371333 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102371333 (RAB10)    04031 GTP-binding proteins [BR:asn04031]     102371333 (RAB10) Membrane trafficking [BR:asn04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102371333 (RAB10)  Protein recycling   Rab GTPases and associated proteins     102371333 (RAB10) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102371333 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    102371333 (RAB10)   Exosomal proteins of colorectal cancer cells    102371333 (RAB10)   Exosomal proteins of bladder cancer cells    102371333 (RAB10) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102371333 (RAB10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA DUF3963 Efg1 Motif Other DBs NCBI-GeneID:  102371333 NCBI-ProteinID:  XP_006032441 UniProt:  A0A1U7SB27 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search MWHTTLKAWLTFLSFFPLGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMG IMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVLKAKGEQIAREH GIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atgtggcacaccactcttaaagcatggctgacatttctttctttcttccccctaggaata gacttcaagatcaaaacagttgaattacaaggaaagaagatcaagctacaaatatgggac acagcaggacaggagcgatttcacaccatcaccacctcctactacagaggcgccatggga attatgctagtgtatgacatcactaatgccaaaagctttgaaaacatcagcaaatggctc agaaacatagatgagcatgccaatgaagatgttgagaggatgctgttaggaaacaagtgc gacatggaagataaacgagttgtccttaaagcaaaaggagaacagattgcaagggagcat ggtattaggtttttcgaaactagtgcaaaagcaaatataaacattgagaaggcattcctc acattagcagaagacattcttcgaaagacccctgtaaaagagcccaacagtgaaaatgta gatatcagcagtggaggtggagtgacaggctggaagagcaagtgttgctga

DBGET integrated database retrieval system