Alligator sinensis (Chinese alligator): 102373024 Help Entry 102373024         CDS       T02922                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04810   Regulation of actin cytoskeleton asn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asn00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102373024 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102373024 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102373024 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:asn04812]     102373024 (PFN2)    04147 Exosome [BR:asn04147]     102373024 (PFN2) Membrane trafficking [BR:asn04131]  Others   Actin-binding proteins    Others     102373024 (PFN2) Cytoskeleton proteins [BR:asn04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102373024 (PFN2) Exosome [BR:asn04147]  Exosomal proteins   Proteins found in most exosomes    102373024 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102373024 NCBI-ProteinID:  XP_006036707 UniProt:  A0A1U7SJ54 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search QPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAV GRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt cagccagtagaaattgatatgattgtaggtaaagaccgcgagggtttcttcaccaatggt ctgactcttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtggatggtgac tgcacgatggacataaggacaaagagccaaggtggcgagccaacatacaatgttgctgta ggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcgga ttgaataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system