Alligator sinensis (Chinese alligator): 102377583 Help Entry 102377583         CDS       T02922                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04081   Hormone signaling asn04144   Endocytosis asn04150   mTOR signaling pathway asn04270   Vascular smooth muscle contraction asn04310   Wnt signaling pathway asn04350   TGF-beta signaling pathway asn04510   Focal adhesion asn04520   Adherens junction asn04530   Tight junction asn04621   NOD-like receptor signaling pathway asn04625   C-type lectin receptor signaling pathway asn04810   Regulation of actin cytoskeleton asn05100   Bacterial invasion of epithelial cells asn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102377583 (RHOA)    04350 TGF-beta signaling pathway     102377583 (RHOA)    04150 mTOR signaling pathway     102377583 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102377583 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102377583 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102377583 (RHOA)    04520 Adherens junction     102377583 (RHOA)    04530 Tight junction     102377583 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102377583 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102377583 (RHOA)    04625 C-type lectin receptor signaling pathway     102377583 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102377583 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102377583 (RHOA)    05100 Bacterial invasion of epithelial cells     102377583 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102377583 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102377583 (RHOA)    04031 GTP-binding proteins [BR:asn04031]     102377583 (RHOA) Membrane trafficking [BR:asn04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102377583 (RHOA) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102377583 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102377583 (RHOA)   Exosomal proteins of colorectal cancer cells    102377583 (RHOA)   Exosomal proteins of bladder cancer cells    102377583 (RHOA) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102377583 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102377583 NCBI-ProteinID:  XP_006028317 UniProt:  A0A1U7SAB9 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtcggtgatggagcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtttatgttcctacagtgtttgaa aattatgtagcagatattgaagtggatggaaagcaggttgagttggccttgtgggataca gcagggcaagaagattatgatcgacttagacctctttcatatccagatacagatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacattccagagaagtggact cctgaggtgaaacatttctgtcccaatgtacctatcattctggtaggaaacaagaaggac ttgaggaatgatgagcacacaagacgggagctggccaaaatgaagcaggagcctgtaaaa cctgaagaaggcagagacatggcaaaccgcattagtgcatttggatatatggaatgctct gcaaagaccaaagatggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaaatctgggtgccttctcttgtaa

DBGET integrated database retrieval system