Alligator sinensis (Chinese alligator): 102378571 Help Entry 102378571         CDS       T02922                                  Symbol NME3 Name (RefSeq) nucleoside diphosphate kinase 3   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism asn  Alligator sinensis (Chinese alligator) Pathway asn00230   Purine metabolism asn00240   Pyrimidine metabolism asn00983   Drug metabolism - other enzymes asn01100   Metabolic pathways asn01232   Nucleotide metabolism asn01240   Biosynthesis of cofactors Module asn_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP asn_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP asn_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP asn_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP asn_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:asn00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     102378571 (NME3)    00240 Pyrimidine metabolism     102378571 (NME3)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     102378571 (NME3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102378571 (NME3) Enzymes [BR:asn01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      102378571 (NME3) Membrane trafficking [BR:asn04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     102378571 (NME3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK PSI_PsaJ Motif Other DBs NCBI-GeneID:  102378571 NCBI-ProteinID:  XP_025059869 UniProt:  A0A3Q0GJJ3 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MKLVQASEDLLSEHYFALRDRPFYNHLVKYMSSGPVVAMVWQGLDVVKTARAMIGETNPA DSRPGTIRGDFCIEVGKNVIHGSDSIESARREISLWFREDELICWEDHAEHWIHE NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaagctggtgcaggcctcagaggacctactgagtgaacattactttgcccttcgcgat cgccccttctacaatcatctggtgaagtacatgagctcgggtcctgttgtcgccatggtt tggcagggattggatgtggtgaaaactgctcgtgcaatgattggagaaactaatccagct gattccagacctggcaccatccgtggggatttctgcattgaagttggcaagaacgtgatt catggcagtgactctattgagagtgcacgaagggagatttcactctggttccgtgaagat gagctgatctgctgggaggaccatgctgagcactggatccatgagtaa

DBGET integrated database retrieval system