Alligator sinensis (Chinese alligator): 102379751 Help Entry 102379751         CDS       T02922                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04137   Mitophagy - animal asn04140   Autophagy - animal asn04144   Endocytosis asn04145   Phagosome asn04148   Efferocytosis asn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102379751 (RAB7A)    04145 Phagosome     102379751 (RAB7A)    04140 Autophagy - animal     102379751 (RAB7A)    04137 Mitophagy - animal     102379751 (RAB7A)    04148 Efferocytosis     102379751 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102379751 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102379751 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102379751 (RAB7A)    04031 GTP-binding proteins [BR:asn04031]     102379751 (RAB7A) Membrane trafficking [BR:asn04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102379751 (RAB7A) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102379751 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102379751 (RAB7A)   Exosomal proteins of colorectal cancer cells    102379751 (RAB7A)   Exosomal proteins of bladder cancer cells    102379751 (RAB7A) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102379751 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102379751 NCBI-ProteinID:  XP_006017827 UniProt:  A0A1U7R5W3 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtgggg aagacatcacttatgaaccagtatgtgaacaagaaattcagtaaccagtacaaagctaca ataggagcagacttcctgacaaaggaggtgatggtggatgacagactagtgacaatgcag atatgggatacggcagggcaagaacggtttcagtctctgggtgttgccttctacagagga gcagactgctgtgtgctggtgtttgatgtgacggcccccaatacatttaaaactctagat agctggagggatgagtttctcattcaggccagtccaagagaccctgagaactttccattt gttgtgctgggaaacaagattgacctagaaaacagacaagttaccacaaaacgagcacaa gcctggtgctacagtaaaaacaacatcccatattttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagactattgcacgaaatgcacttaaacaggaaaccgaggtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagcaaaagcc tctgcagagagctgcagctgctga

DBGET integrated database retrieval system