Alligator sinensis (Chinese alligator): 102380807 Help Entry 102380807         CDS       T02922                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04010   MAPK signaling pathway asn04012   ErbB signaling pathway asn04068   FoxO signaling pathway asn04137   Mitophagy - animal asn04140   Autophagy - animal asn04144   Endocytosis asn04150   mTOR signaling pathway asn04210   Apoptosis asn04218   Cellular senescence asn04370   VEGF signaling pathway asn04371   Apelin signaling pathway asn04510   Focal adhesion asn04540   Gap junction asn04625   C-type lectin receptor signaling pathway asn04810   Regulation of actin cytoskeleton asn04910   Insulin signaling pathway asn04912   GnRH signaling pathway asn04916   Melanogenesis asn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102380807 (HRAS)    04012 ErbB signaling pathway     102380807 (HRAS)    04370 VEGF signaling pathway     102380807 (HRAS)    04371 Apelin signaling pathway     102380807 (HRAS)    04068 FoxO signaling pathway     102380807 (HRAS)    04150 mTOR signaling pathway     102380807 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102380807 (HRAS)    04140 Autophagy - animal     102380807 (HRAS)    04137 Mitophagy - animal     102380807 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102380807 (HRAS)    04218 Cellular senescence     102380807 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102380807 (HRAS)    04540 Gap junction     102380807 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102380807 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102380807 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102380807 (HRAS)    04912 GnRH signaling pathway     102380807 (HRAS)    04916 Melanogenesis     102380807 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102380807 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102380807 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102380807 (HRAS)    04031 GTP-binding proteins [BR:asn04031]     102380807 (HRAS) Membrane trafficking [BR:asn04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102380807 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102380807 (HRAS) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102380807 (HRAS)   Exosomal proteins of colorectal cancer cells    102380807 (HRAS) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102380807 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  102380807 NCBI-ProteinID:  XP_006019257 UniProt:  A0A1U7RJK5 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggttggagcaggtggcgttgggaagagcgctttgaca atacagctcattcagaaccattttgttgatgaatatgaccccacaatagaggattcctat agaaaacaggtagtcattgatggagaaacctgtttattagacatcttggacacagcagga caagaggagtacagcgccatgcgagaccagtacatgaggacgggggagggcttcctgtgc gtcttcgccattaacaatactaagtcctttgaagacattcaccagtatagagagcagatc aagagagtgaaggactcggacgatgtccccatggtgctggtggggaacaaatgtgacctg ccagcccggacagtggagacccggcaagcacaggatttggccaggagttacgggatcccc tacatagagacatctgctaaaaccagacagggggtcgaagacgccttctacaccttagtg cgggagatccggcagcacaagctgcgcaagttaaatcctccggatgaaagcggcccgggc tgcatgaactgtaaatgtgtgatctcatga

DBGET integrated database retrieval system