Alligator sinensis (Chinese alligator): 102382019 Help Entry 102382019         CDS       T02922                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04010   MAPK signaling pathway asn04012   ErbB signaling pathway asn04068   FoxO signaling pathway asn04137   Mitophagy - animal asn04140   Autophagy - animal asn04150   mTOR signaling pathway asn04210   Apoptosis asn04218   Cellular senescence asn04370   VEGF signaling pathway asn04371   Apelin signaling pathway asn04540   Gap junction asn04625   C-type lectin receptor signaling pathway asn04810   Regulation of actin cytoskeleton asn04910   Insulin signaling pathway asn04912   GnRH signaling pathway asn04916   Melanogenesis Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102382019 (NRAS)    04012 ErbB signaling pathway     102382019 (NRAS)    04370 VEGF signaling pathway     102382019 (NRAS)    04371 Apelin signaling pathway     102382019 (NRAS)    04068 FoxO signaling pathway     102382019 (NRAS)    04150 mTOR signaling pathway     102382019 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102382019 (NRAS)    04137 Mitophagy - animal     102382019 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102382019 (NRAS)    04218 Cellular senescence     102382019 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102382019 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102382019 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102382019 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102382019 (NRAS)    04912 GnRH signaling pathway     102382019 (NRAS)    04916 Melanogenesis     102382019 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asn04131]     102382019 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102382019 (NRAS)    04031 GTP-binding proteins [BR:asn04031]     102382019 (NRAS) Membrane trafficking [BR:asn04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102382019 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102382019 (NRAS) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102382019 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102382019 (NRAS)   Exosomal proteins of breast cancer cells    102382019 (NRAS)   Exosomal proteins of colorectal cancer cells    102382019 (NRAS) GTP-binding proteins [BR:asn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102382019 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras GTP_EFTU FeoB_N Arf RsgA_GTPase Motif Other DBs NCBI-GeneID:  102382019 NCBI-ProteinID:  XP_006035806 UniProt:  A0A1U7SHG5 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search ARFSREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTRQAQELAKSYSIPFIETSAKTRQGV EDAFYTLVREIRQYRMKKLDSSEDGNQGCMGVSCIMM NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gcccgcttctccagggagcagatcaagagagtgaaggactcggacgacgtgcccatggtg ctcgtggggaacaagtgcgacctgcccacgcggacggtggacacgaggcaagcgcaggag ctggccaagagctacagcatccccttcatagagacgtctgccaagacgagacagggcgtg gaggacgccttctacacgctggtgcgagagatccgccagtaccggatgaaaaagctcgac agcagcgaggacgggaatcagggctgcatgggagtgtcgtgcatcatgatgtga

DBGET integrated database retrieval system