Alligator sinensis (Chinese alligator): 102383833 Help Entry 102383833         CDS       T02922                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04382   Cornified envelope formation asn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asn00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102383833 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102383833 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asn04147]     102383833 (S100A10) Exosome [BR:asn04147]  Exosomal proteins   Exosomal proteins of microglial cells    102383833 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  102383833 NCBI-ProteinID:  XP_006036288 UniProt:  A0A1U8DW44 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKSFLSKEDLRLLMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcagatggaacatgccatggagaccctcatgttcaccttccacaagtacgcg ggggacaagagcttcctctctaaagaagacctccggcttctcatggagaaggagttcccc ggcttcctggagaaccagagggaccctatggctctggataaaatcatgaaggacctggac cagtgccgggacgggaaagtcggcttccagagtttcttctcactggtggccgggctcacc attgcctgcaacgactactttgtggtgcacatgaagcagaaggggaagaaatga

DBGET integrated database retrieval system