KEGG   Alligator sinensis (Chinese alligator): 106722914
Entry
106722914         CDS       T02922                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
asn  Alligator sinensis (Chinese alligator)
SSDB
Motif
Pfam: MRAP EVC2_like
Other DBs
NCBI-GeneID: 106722914
NCBI-ProteinID: XP_014381203
UniProt: A0A1U8DIX2
LinkDB
Position
Unknown
AA seq 88 aa
MANRTNSSEYYWSYEYYWDYFDPFPVDGRTLKVHKYSIVIAFWVGLAAFLMFLFLILLYM
SRSGSTPVKQVAINNREEENSSNGDCFT
NT seq 267 nt   +upstreamnt  +downstreamnt
atggctaacagaacaaactcatctgagtattactggtcttatgaatattattgggactat
tttgatccatttccagtagatggaaggacgttgaaggttcataaatattcaattgtcata
gccttttgggttggacttgctgcattcttgatgtttctcttcctcattttgctctacatg
tccagatctggatccacaccagtaaaacaagtggctataaataaccgggaagaagaaaac
agctccaacggtgactgtttcacatag

DBGET integrated database retrieval system