Alligator sinensis (Chinese alligator): 112549256 Help Entry 112549256         CDS       T02922                                  Name (RefSeq) pancreatic hormone-like   KO K05233   peptide YY Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112549256  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asn04052]     112549256 Cytokines and neuropeptides [BR:asn04052]  Neuropeptides   GPCR binding    112549256 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  112549256 NCBI-ProteinID:  XP_025052647 UniProt:  A0A3Q0FZF2 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MASRGRWDTLFALTCCMAVLIGHAANATPLQPKYPGDGAPVEDLIQFYNDLQQYLNVVTR PRFGKRSGSQALCGDPYRLTGC NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtggacgctgggacactctctttgccctcacctgctgcatggctgtgctc attgggcatgctgccaatgccacccccctgcagcccaagtaccctggggatggtgctcct gtagaggacctgatccagttctacaatgacctgcagcagtatctcaatgtggtcacacgg cccaggttcggcaagaggtctggcagccaggccctctgtggggacccctaccgcctcaca ggatgctaa

DBGET integrated database retrieval system