Agromyces soli: MTP13_14670 Help Entry MTP13_14670       CDS       T08198                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asoi  Agromyces soli Pathway asoi01100   Metabolic pathways asoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asoi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MTP13_14670    00074 Mycolic acid biosynthesis     MTP13_14670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MTP13_14670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Motif Other DBs NCBI-ProteinID:  UOE25561 LinkDB All DBs Position 3055064..3055312 Genome browser AA seq 82 aa AA seqDB search MALSNEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVSFIVKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcattgtccaacgaagaagtgctggccggcctggccgagctcatcaacgacgagacc ggcatcgcgaccgacacggttgagctggacaagtcgttcaccgatgacctcgatatcgac tccatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgatgtcaagatcccc gacgaagaggtgaagaacctcaagaccgtcggcgacgccgtcagcttcatcgtcaaggcc caggcctag

DBGET integrated database retrieval system