Acinetobacter soli: BEN76_15765 Help Entry BEN76_15765       CDS       T04684                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asol  Acinetobacter soli Pathway asol01100   Metabolic pathways asol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BEN76_15765    00074 Mycolic acid biosynthesis     BEN76_15765   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BEN76_15765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APV37379 UniProt:  A0A1P8EME2 LinkDB All DBs Position 3340874..3341134 Genome browser AA seq 86 aa AA seqDB search MSNLANELKQMIIDVLALEDIQAADIDDTAPLFGEGLGLDSIDALELGLALKKRYNIHLN AESDETKQHFRSIQSLVALVESQQKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcttgcgaatgaattaaaacaaatgatcattgatgtattggcattggaagat attcaagccgctgacattgatgatactgcaccgctttttggtgaaggcttggggctcgat tctattgatgccttggagctgggtttggcccttaaaaaacgctacaacattcatttgaat gctgaatcggatgaaaccaaacagcattttcgttcgatccagagcttggtggctttggtt gaaagtcagcaaaaagcctga

DBGET integrated database retrieval system