Aeromonas schubertii: WL1483_2687 Help Entry WL1483_2687       CDS       T04186                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asr  Aeromonas schubertii Pathway asr01100   Metabolic pathways asr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WL1483_2687 (acpP2)    00074 Mycolic acid biosynthesis     WL1483_2687 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WL1483_2687 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALP42106 UniProt:  A0A0S2SK75 LinkDB All DBs Position complement(3370480..3370725) Genome browser AA seq 81 aa AA seqDB search MTRDDIFNEIRNALVELFEIDPEAVTLDAQLYQQLELDSIDAIDLVVHLQKLTGKKIKPE EFKSVRTVADVVDAVERLLAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccagagacgatatcttcaacgagatccgcaatgccctggtcgagctgttcgagatc gatcccgaggccgtgaccctggatgcccagctctaccagcaactcgagctcgacagcatc gacgccatcgatctggtggtgcatctgcagaagctgaccggcaagaagatcaagccggag gagttcaagtcggtgcgcaccgtcgccgacgtggtcgacgcggtcgagcgcttgctcgca gagtaa

DBGET integrated database retrieval system