Archaeoglobus sulfaticallidus: Asulf_00083 Help Entry Asulf_00083       CDS       T02642                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ast  Archaeoglobus sulfaticallidus Pathway ast03010   Ribosome Brite KEGG Orthology (KO) [BR:ast00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Asulf_00083   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Asulf_00083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ast03011]     Asulf_00083    04121 Ubiquitin system [BR:ast04121]     Asulf_00083   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ast04147]     Asulf_00083 Ribosome [BR:ast03011]  Ribosomal proteins   Eukaryotes    Small subunit     Asulf_00083   Archaea     Asulf_00083 Ubiquitin system [BR:ast04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Asulf_00083 Exosome [BR:ast04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Asulf_00083   Exosomal proteins of colorectal cancer cells    Asulf_00083 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Zn_Ribbon_1 Ribosomal_L37e IBR MqsA_antitoxin Lar_restr_allev C1_1 Zn_ribbon_RPB9 Zn_ribbon_IS1595 Zn_ribbon_NUD DZR_2 DUF6671 IBR_1 Zn_ribbon_NrdR DZR Cas12f1-like_TNB DUF1451 Zn_ribbon_NOB1 Zn_Ribbon_TF Zn_ribbon_13 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  AGK60119 UniProt:  N0B916 LinkDB All DBs Position complement(72287..72436) Genome browser AA seq 49 aa AA seqDB search MTVSKFYEIKGEKLIRKRKFCPRCGEGVFLAEHKDRLSCGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgacagtctcaaagttctatgagataaagggcgagaagctaatcaggaagaggaagttc tgcccgagatgtggagagggcgtatttctcgcggaacacaaggacagactctcctgtggg aagtgcggatatactgaattcaagaaataa

DBGET integrated database retrieval system