KEGG   Archaeoglobus sulfaticallidus: Asulf_01219
Entry
Asulf_01219       CDS       T02642                                 
Name
(GenBank) hypothetical protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
ast02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ast00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Asulf_01219
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Asulf_01219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ast02022]
    Asulf_01219
   02035 Bacterial motility proteins [BR:ast02035]
    Asulf_01219
Two-component system [BR:ast02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Asulf_01219
Bacterial motility proteins [BR:ast02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Asulf_01219
SSDB
Motif
Pfam: Response_reg MTD B12-binding
Other DBs
NCBI-ProteinID: AGK61217
UniProt: N0BFY8
LinkDB
Position
1114235..1114591
AA seq 118 aa
MRVLIVDDDSGIREILRLMLSEYTVLEASNGDEAVKHYKNFKPDVVIMDAVMPVMDGVAA
TRRILEIDPNAKVVALTAYYTTKAREMLEAGSVEALEKPFSKKIILEIVRKYCRYSNY
NT seq 357 nt   +upstreamnt  +downstreamnt
atgagagttctgattgttgatgatgattcaggaattcgagagattttaaggcttatgctc
tctgagtacacagttttggaagcttccaatggagatgaagcagttaaacattacaaaaac
ttcaaaccagacgttgtgataatggatgctgtcatgccagtgatggatggagttgccgca
accaggaggatactggagattgacccgaatgccaaggttgtagcactcacggcatactac
acaacgaaagccagagagatgctcgaagctggctctgtagaggctctggaaaaacccttc
tcgaagaagatcattctcgaaatagttagaaagtactgcaggtattcaaactactga

DBGET integrated database retrieval system