KEGG   Asticcacaulis sp. DW145: ATDW_13830
Entry
ATDW_13830        CDS       T10232                                 
Name
(GenBank) energy transducer TonB
  KO
K03832  periplasmic protein TonB
Organism
astd  Asticcacaulis sp. DW145
Brite
KEGG Orthology (KO) [BR:astd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:astd02000]
    ATDW_13830
Transporters [BR:astd02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ATDW_13830
SSDB
Motif
Pfam: TonB_C
Other DBs
NCBI-ProteinID: BEV10887
LinkDB
Position
1:complement(1530544..1531194)
AA seq 216 aa
MFVGIGVAIVAHVGLAYYIYHEKFEIKPVEYEDTKIDTELVDLAPPPPPPPPPPPPPPDM
PPPPPKLQVREPVIQTDAPPPPAPIQIEATKKEDRVEYKGPPQIVPGPPPPPAPVVPAGP
RYTTAQWTPPTSDQMLDLYPPRAQDAEVEGEVTIDCVLSSEGKITGCSVESEKPAGYGFG
AATVKGFMRYAKIKKGTDGELRDGDHKKFRFKWTLQ
NT seq 651 nt   +upstreamnt  +downstreamnt
ttgttcgtcggtattggcgtggcgatcgtggcccacgtgggactggcctactacatctat
cacgaaaagttcgaaatcaagccggtggaatatgaggacaccaagattgatactgaactg
gtagatctggcgccgcccccgccgcctccaccgccgccgccgccgccgccgcctgacatg
cctccgcctccgccgaagctgcaggttcgcgaaccggtgatccagaccgacgcacctccg
ccgcctgctccgatccagatcgaagcgacgaagaaggaagaccgcgtcgagtataagggg
ccgccgcaaatcgtcccgggacctccgccgcctccggctccggtcgttcccgctggtccg
cgctacacgacggctcaatggacgccgccgacgtcggaccagatgcttgacctctacccg
ccgcgtgctcaggacgcggaagttgaaggcgaagtcaccattgactgcgtcctcagctcg
gaaggcaagatcacgggctgtagcgtcgaaagcgaaaagcctgcgggctatggcttcggt
gcggcgaccgtgaagggctttatgcgctacgccaagatcaagaagggcaccgatggtgaa
cttcgtgacggcgaccacaagaagttccgcttcaagtggaccctgcaatag

DBGET integrated database retrieval system