Asticcacaulis sp. DW145: ATDW_28700 Help Entry ATDW_28700        CDS       T10232                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism astd  Asticcacaulis sp. DW145 Pathway astd02024   Quorum sensing astd03018   RNA degradation Brite KEGG Orthology (KO) [BR:astd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ATDW_28700 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ATDW_28700 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:astd03019]     ATDW_28700 (hfq)    03036 Chromosome and associated proteins [BR:astd03036]     ATDW_28700 (hfq) Messenger RNA biogenesis [BR:astd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ATDW_28700 (hfq) Chromosome and associated proteins [BR:astd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ATDW_28700 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  BEV12374 LinkDB All DBs Position 2:complement(757186..757434) Genome browser AA seq 82 aa AA seqDB search MSHEKKQNLQDTFLNSVRKSKTPLTIFLINGVKLQGIVSWFDNFCVLLRRDGQSQLVYKH AISTIMPAAPVQLYEQEEDSDD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcccacgaaaagaaacaaaacctgcaggacacgttccttaacagcgttcgtaaatcc aaaacgcctctcaccatcttcctgatcaacggcgtcaagcttcagggtatcgttagctgg ttcgacaatttctgcgtgctgctgcgccgcgacggtcagtcgcaactggtctataagcac gcgatctcgaccatcatgcctgccgcgccggtgcaactgtacgagcaggaagaagactcg gacgattaa

DBGET integrated database retrieval system