Anopheles stephensi (Asian malaria mosquito): 118511765
Help
Entry
118511765 CDS
T08252
Name
(RefSeq) S-phase kinase-associated protein 1-like
KO
K03094
S-phase kinase-associated protein 1
Organism
aste
Anopheles stephensi (Asian malaria mosquito)
Pathway
aste03083
Polycomb repressive complex
aste04120
Ubiquitin mediated proteolysis
aste04141
Protein processing in endoplasmic reticulum
aste04310
Wnt signaling pathway
aste04341
Hedgehog signaling pathway - fly
aste04350
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:
aste00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
118511765
04120 Ubiquitin mediated proteolysis
118511765
09126 Chromosome
03083 Polycomb repressive complex
118511765
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
118511765
04341 Hedgehog signaling pathway - fly
118511765
04350 TGF-beta signaling pathway
118511765
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
aste04131
]
118511765
04121 Ubiquitin system [BR:
aste04121
]
118511765
03036 Chromosome and associated proteins [BR:
aste03036
]
118511765
Membrane trafficking [BR:
aste04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
118511765
Ubiquitin system [BR:
aste04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
118511765
Cul7 complex
118511765
Chromosome and associated proteins [BR:
aste03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
118511765
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
118511765
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
Imm5
Motif
Other DBs
NCBI-GeneID:
118511765
NCBI-ProteinID:
XP_035911131
LinkDB
All DBs
Position
3:complement(66894356..66895564)
Genome browser
AA seq
162 aa
AA seq
DB search
MPTIRLQSSDGEIFDTDVQIAKCSGTIKTMLEDLGMDEGDDEVVPLPNVNSAILRKVLQW
ATFHKDDPIPVEDDDSKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTPAEEEQVRKENEWCEEK
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgcctaccatcagactacagtcgtcggacggtgaaattttcgacaccgatgtgcagatc
gccaaatgctccggcaccatcaaaacgatgctggaagatttgggcatggacgagggtgac
gatgaggtcgtaccgctgccgaacgtaaactcggccatcctgcggaaggtgctacagtgg
gccaccttccacaaggacgatccgatcccggtggaagacgacgatagcaaagaaaagcgc
accgacgacatcagttcgtgggacgctgacttcctgaaggtggaccagggcacgctgttc
gagctgatcctggccgcgaactatttggacattaaggggctgctggacgtgacgtgcaaa
accgtggcgaacatgatcaagggcaaaaccccggaagagattcgcaagacgttcaacatc
aagaacgacttcacgccggccgaggaggaacaggtgcgcaaggagaatgagtggtgtgag
gaaaagtag
DBGET
integrated database retrieval system