Asticcacaulis sp. MM231: MMA231_04235 Help Entry MMA231_04235      CDS       T10530                                  Symbol secB_2 Name (GenBank) Protein-export protein SecB   KO K03071   preprotein translocase subunit SecB Organism astm  Asticcacaulis sp. MM231 Pathway astm02024   Quorum sensing astm03060   Protein export astm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:astm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MMA231_04235 (secB_2)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MMA231_04235 (secB_2)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MMA231_04235 (secB_2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:astm03110]     MMA231_04235 (secB_2)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:astm02044]     MMA231_04235 (secB_2) Chaperones and folding catalysts [BR:astm03110]  Other chaperones and cochaperones   SecB    MMA231_04235 (secB_2) Secretion system [BR:astm02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    MMA231_04235 (secB_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  CAL4869943 UniProt:  A0AAT9J456 LinkDB All DBs Position MM231_p2:386525..386917 Genome browser AA seq 130 aa AA seqDB search MTQTLKIRQIYLKDLSYQAPTGAEIFTREWSPKVKVDMKLENSHLSGSLYEVVLTLSIVT TSAGSTAYMIELMQAGIFELTGYTDAQREQVLGGKCASILFPYARETVEGLLMKARLPAL ILDPIDFETN NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgacgcaaaccttaaaaatccgccagatctacctcaaggacctgtcctatcaggccccg accggagccgagatcttcacgcgcgaatggtcgcccaaggtcaaggtcgatatgaagctg gaaaacagccatctgtcgggttcgctttacgaggtcgtcctgacgctctcgatcgtgacc accagcgcaggcagcaccgcctatatgatcgagcttatgcaggctggcatcttcgagctc accggctacaccgatgcccagcgcgagcaggttcttggcggcaaatgcgccagcattctc ttcccctatgcgcgcgagacggttgaaggcctgttgatgaaggcacgcctcccggcgctc atcctcgacccgatcgacttcgaaacgaactga

DBGET integrated database retrieval system