Armigeres subalbatus: 134208855 Help Entry 134208855         CDS       T09975                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism asua  Armigeres subalbatus Pathway asua04013   MAPK signaling pathway - fly asua04145   Phagosome asua04148   Efferocytosis asua04310   Wnt signaling pathway asua04620   Toll-like receptor signaling pathway asua05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:asua00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     134208855    04310 Wnt signaling pathway     134208855  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     134208855    04148 Efferocytosis     134208855  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     134208855  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     134208855  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asua04131]     134208855   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asua04147]     134208855    04031 GTP-binding proteins [BR:asua04031]     134208855 Membrane trafficking [BR:asua04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     134208855  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     134208855   Macropinocytosis    Ras GTPases     134208855  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     134208855 Exosome [BR:asua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134208855   Exosomal proteins of other body fluids (saliva and urine)    134208855   Exosomal proteins of colorectal cancer cells    134208855   Exosomal proteins of bladder cancer cells    134208855 GTP-binding proteins [BR:asua04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     134208855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  134208855 NCBI-ProteinID:  XP_062540784 LinkDB All DBs Position 2:68556951..68574159 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKQTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPI IPVKNKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtcgtggtgggcgatggtgccgtcggtaagacttgtctcctg atcagttacacgaccaatgccttcccgggggaatacattccgaccgtgttcgacaactac tctgccaatgtgatggtcgacggaaagccaatcaacctgggactgtgggatacggccgga caggaagattacgatcgcctgcggccactgtcctatccgcaaacggacgtgttcctcata tgcttctcattggtcaatccggcctcgttcgagaacgtccgggcaaagtggtacccggag gtgcgccaccattgccctaacataccgataattttggtaggaaccaaactcgatctgaga gatgataagcagacagtggataagttacgcgataagaagctctcgccgatcacctatccc cagggactggctatggccaaggaaatcggtgccgttaaatatttggaatgctccgccctt acccagaagggcctcaaaaccgtattcgacgaagcgatccgagcagtgctttgtcccatc attccggtgaaaaacaaacgtaaatgttcaattctgtaa

DBGET integrated database retrieval system