Armigeres subalbatus: 134223398 Help Entry 134223398         CDS       T09975                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism asua  Armigeres subalbatus Pathway asua04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:asua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134223398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:asua04121]     134223398    03400 DNA repair and recombination proteins [BR:asua03400]     134223398 Ubiquitin system [BR:asua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134223398    Cul5 complex      134223398 DNA repair and recombination proteins [BR:asua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134223398 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  134223398 NCBI-ProteinID:  XP_062558521 LinkDB All DBs Position 1 Genome browser AA seq 118 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVHELKRMIEGILKVPPRDQRLYNKDNQLMDDDRTLQD CGITVATAKAQCPAQLGLAVRENSGDFEQLDLTPYSLPPDLPDVMNKQDAANGQDQLA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcatgatgatcagacggaagaagaccaccatcttcaccgatgccaaagaa accacgccggtccacgagcttaagcgaatgatcgaaggaatcctgaaagtgcctccccgg gaccagcgcctgtacaacaaggacaaccaactgatggacgacgaccggacgctgcaggac tgcggtataacggtggccacagccaaggcacagtgcccggcccagctcggtttggccgtc cgggaaaacagcggcgatttcgagcagctggatctgactccgtactcgctgcccccggat ctaccggacgtgatgaacaaacaggacgccgccaacggacaggatcagcttgcctaa

DBGET integrated database retrieval system