Atlantibacter subterraneus: NLZ15_01115 Help Entry NLZ15_01115       CDS       T08300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asub  Atlantibacter subterraneus Pathway asub01100   Metabolic pathways asub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asub00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NLZ15_01115    00074 Mycolic acid biosynthesis     NLZ15_01115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NLZ15_01115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UTJ47701 LinkDB All DBs Position complement(242835..243086) Genome browser AA seq 83 aa AA seqDB search MVDKHAIYQEVSALLTQLFEIPAEDISPEARLYEDLELDSIDAVDMVVHLQKKTGKKIKP ETFKSVRTVQDVVDAVERLLNDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggttgataaacacgcgatttaccaggaagtctccgcacttctgacccagcttttcgaa attcccgccgaggacatctcccccgaggcgcgtctgtacgaggatctggaactcgacagc atcgacgccgtggacatggtggtgcatctgcaaaagaaaaccggcaaaaaaatcaaacct gaaacgttcaaatcggtgcgtaccgttcaggacgtcgtggacgcggttgagcgtctgctg aacgacgcgtaa

DBGET integrated database retrieval system