Atlantibacter subterraneus: NLZ15_10530 Help Entry NLZ15_10530       CDS       T08300                                  Symbol pptA Name (GenBank) tautomerase PptA   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism asub  Atlantibacter subterraneus Pathway asub00362   Benzoate degradation asub01100   Metabolic pathways asub01120   Microbial metabolism in diverse environments asub01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:asub00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     NLZ15_10530 (pptA)    00622 Xylene degradation     NLZ15_10530 (pptA)    00621 Dioxin degradation     NLZ15_10530 (pptA) Enzymes [BR:asub01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      NLZ15_10530 (pptA) SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  UTJ49414 LinkDB All DBs Position 2233623..2233853 Genome browser AA seq 76 aa AA seqDB search MPHVDIKFFPRDLTEEQRQAFADDIANVVIKHLDSKPTSVSVALEQVQPDNWKAQVWDTE IAPNLDTLAKKPGYSM NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccgcatgtagatattaaatttttcccacgtgacttaaccgaagagcagcgccaggcg tttgccgacgatatcgctaacgtggtgataaaacatctcgacagcaaaccgacctcggtg agcgtggcgctggaacaggtccagccggataactggaaagcgcaggtatgggataccgaa atcgcgccgaatctggatactctggcgaagaaacccggttacagcatgtaa

DBGET integrated database retrieval system