Atlantibacter subterraneus: NLZ15_21715 Help Entry NLZ15_21715       CDS       T08300                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism asub  Atlantibacter subterraneus Brite KEGG Orthology (KO) [BR:asub00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:asub03110]     NLZ15_21715 (grxC) Chaperones and folding catalysts [BR:asub03110]  Protein folding catalysts   Protein disulfide isomerase    NLZ15_21715 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 GST_N Glrx-like SH3BGR Thioredoxin_3 Thioredoxin_2 CLIC-like_N DSBA Motif Other DBs NCBI-ProteinID:  UTJ47376 LinkDB All DBs Position complement(4575381..4575632) Genome browser AA seq 83 aa AA seqDB search MANIEIYTKVTCPYCHRAKALLASKGVAFEELPIDGDAAKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatatcgaaatctataccaaagtgacctgcccttactgccatcgcgcaaaagcg ttgctggcgagcaaaggcgtcgcgtttgaagagctacccattgacggggacgctgctaaa cgggaagagatgattaagcgcagtggccgcaccacggtgccgcaaatttttattgatgca cagcacattggcggttgtgacgacttgtatgcgctggatgcgcgtggtggactcgatccc ctgttgcgctag

DBGET integrated database retrieval system