Arcobacter suis: ASUIS_2310 Help Entry ASUIS_2310        CDS       T06792                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asui  Arcobacter suis Pathway asui01100   Metabolic pathways asui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASUIS_2310 (acpP1)    00074 Mycolic acid biosynthesis     ASUIS_2310 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASUIS_2310 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXX90728 UniProt:  A0AAD0SS52 LinkDB All DBs Position 2312007..2312237 Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVIEQLDCDPAEVKEDSRFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVADAIKYIENIA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgacgtaaaagaagttgttattgagcaattagattgcgatccagca gaagttaaagaagactcaagatttattgaagatttaggtgctgactctttagatgtagtt gaattagttatggctttagaggaaaaatttgacattgaaatccctgatgaagatgcagag aaaatcttaacagttgcagatgctataaaatacattgagaatatcgcgtaa

DBGET integrated database retrieval system