Arthrobacter sunyaminii: KG104_11865 Help Entry KG104_11865       CDS       T08124                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asun  Arthrobacter sunyaminii Pathway asun01100   Metabolic pathways asun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KG104_11865    00074 Mycolic acid biosynthesis     KG104_11865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KG104_11865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QWQ35194 UniProt:  A0A975PDV7 LinkDB All DBs Position 2636080..2636325 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPESVELDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVDFISKAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggccggcctcgccgagatcgtcaacgaggaaaccggt ctggcccccgagtccgtcgaactggacaagtccttcaccgatgatctggacatcgactcc atctcgatgatgacgatcgtcgtcaacgccgaagagaagttcggcgtgcgcatcccggac gaagaggtcaagaacctgaagaccgtcggcgacgccgtggacttcatttccaaagcccag gcgtaa

DBGET integrated database retrieval system