Acidithiobacillus sulfuriphilus: EC580_005215
Help
Entry
EC580_005215 CDS
T11327
Symbol
ilvB
Name
(GenBank) biosynthetic-type acetolactate synthase large subunit
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
asuu Acidithiobacillus sulfuriphilus
Pathway
asuu00290
Valine, leucine and isoleucine biosynthesis
asuu00660
C5-Branched dibasic acid metabolism
asuu00770
Pantothenate and CoA biosynthesis
asuu01100
Metabolic pathways
asuu01110
Biosynthesis of secondary metabolites
asuu01210
2-Oxocarboxylic acid metabolism
asuu01230
Biosynthesis of amino acids
Module
asuu_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
asuu_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
asuu00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
EC580_005215 (ilvB)
00660 C5-Branched dibasic acid metabolism
EC580_005215 (ilvB)
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
EC580_005215 (ilvB)
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
EC580_005215 (ilvB)
Enzymes [BR:
asuu01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
EC580_005215 (ilvB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
XRI78077
LinkDB
All DBs
Position
1016690..1018435
Genome browser
AA seq
581 aa
AA seq
DB search
MTSPTTTEQRPTAQHQEEELTGAEIVVRALRDEGVEYLYGYPGGAVLYIYDELFKQDAVK
HILVRHEQAAVHAADAYARITGKVGVALVTSGPGATNAVTGIATAYMDSIPLVVITGQVP
VALIGNDAFQEVDTVGITRPCTKHNFLVKDVRDLASTLKTAFHLAATGRPGPVLVDIPKD
ITGHKTLYHYPEKVSLRSYKPTVKGHPGQVRKAMQMIAGAQRPMFYTGGGVILANGAEEL
VKLVRRLGAPVTNTFMGLGGYPASDRQFLGMLGMHGTYEANMAVQNCDVLVAIGARFDDR
VTGNIAKFAPHAKIVHVDIDPSSISKNVRVDIPIVGDLRQVLAEMNQILAEMDHPTDARA
LAAWWAQIEDWRKRDCLHYIQNDEVIKPQFVIQKLYELTGGDAVVTTDVGQHQMWAAQFY
GFDRPRRWASSGGLGTMGYGLPAAMGAQLAEPDSTVLCVTGEGSIQMNIQELSTCLQYRL
PIKIACLNNHYLGMVRQWQEFFYGSRYAMSYVDALPDFVKLAEAFGHVGLRADKPADVEP
VIREALRLKDRLVFMDFQVDPVENVYPMVPAGAALSEMILV
NT seq
1746 nt
NT seq
+upstream
nt +downstream
nt
atgacgtccccgactacgacagaacagcggcccaccgcccagcatcaggaagaagagctg
acgggtgcggagatcgtggtacgcgccctgcgcgacgagggcgttgagtacctctacggt
tatcccggcggtgcggtactctatatttatgacgaactcttcaaacaggatgccgtcaag
cacatcctggttcgtcacgaacaggcggcggttcatgccgccgatgcctatgcgcggatc
accggcaaggtgggcgtggccctggtgaccagcgggccgggggcgaccaatgccgttacc
ggcatcgccaccgcgtatatggattccattcccttggtggtgattaccggacaggtgccg
gtggcactcatcggcaatgatgccttccaggaagtggataccgtcgggatcacccggccc
tgcaccaagcataatttcctggtcaaggatgtccgcgacttggcgagcacgctgaaaacg
gcctttcatctggctgccaccggccgtccagggccggttctggtggacattcccaaagat
attaccggccataagaccctgtaccactatcccgaaaaggtcagcctgcgctcctacaag
ccgacggtgaaggggcatccggggcaggtgcgcaaggcgatgcagatgatcgccggcgcg
cagcggccgatgttctacaccggcggcggggtgatcctcgccaacggggcggaagagttg
gtcaagctggtgcgccgcctgggcgcgcccgtcaccaataccttcatggggctgggcgga
tatccggcctcggatcgccagttcctcggcatgctcggcatgcacggcacctacgaggcc
aacatggcggtgcagaactgtgatgtcctggtggccatcggtgcccgcttcgacgatcgg
gtaacggggaatattgccaagtttgcgccccacgccaagatcgttcacgtcgatatcgac
ccttcgtccatttccaaaaacgtgcgggtggatatccccattgtcggcgatttgcgccag
gtcctggccgagatgaaccagatcctcgcggagatggatcatcccacggatgcccgtgcg
ctggcggcctggtgggcgcagatcgaagactggcgcaagcgcgattgtctgcactacatc
cagaacgatgaggtcatcaagccccagttcgtgatccagaaattgtacgaattgacgggc
ggagatgccgttgtcacaacggacgtgggccagcatcagatgtgggcagcgcagttttac
ggctttgaccggccccggcgctgggccagcagcggcggcctggggaccatgggttacggc
ttgccggcggccatgggtgcgcaattggccgaacccgattccaccgttctctgcgtcacc
ggggaaggcagcatccagatgaacatccaggaattgtccacctgtttgcagtatcggctg
cccatcaagatcgcctgtctcaacaaccattacctgggcatggtgcggcagtggcaggag
ttcttttacggcagccgctacgccatgagttatgtggatgccctgccggacttcgtcaag
ctcgccgaggccttcggtcacgtgggcttgcgcgcggataagcccgccgatgtggaaccg
gtgatccgcgaggccctgcgcctgaaggatcggctggttttcatggactttcaggtagat
ccggtggaaaacgtctatcccatggtcccggccggggcggccctttctgaaatgatcctg
gtctaa
DBGET
integrated database retrieval system