Acidithiobacillus sulfuriphilus: EC580_008795 Help Entry EC580_008795      CDS       T11327                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asuu  Acidithiobacillus sulfuriphilus Pathway asuu01100   Metabolic pathways asuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EC580_008795 (acpP)    00074 Mycolic acid biosynthesis     EC580_008795 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EC580_008795 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  XRI76066 LinkDB All DBs Position complement(1771056..1771304) Genome browser AA seq 82 aa AA seqDB search MDNLAERVKKVVVEQLGVNEDEVTNEASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKIATVQQAIDYIGAHLPAKGE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggacaatttggcagaacgcgttaaaaaagtggtggtagagcaactgggcgtcaacgag gatgaagtcaccaacgaggcctccttcgtggatgacctgggcgcagactccctggacacc gtagaactcgtcatggcactggaagaggagttcgactgcgaaatccccgacgaagaggcg gagaagatcgcaacggtgcagcaggccatcgattacattggcgcccatcttcctgccaag ggtgaatag

DBGET integrated database retrieval system