Achromobacter spanius: CVS48_15470 Help Entry CVS48_15470       CDS       T05274                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asw  Achromobacter spanius Pathway asw01100   Metabolic pathways asw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CVS48_15470    00074 Mycolic acid biosynthesis     CVS48_15470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CVS48_15470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  AUA57296 UniProt:  A0AA42IYQ7 LinkDB All DBs Position complement(3397975..3398229) Genome browser AA seq 84 aa AA seqDB search MHTREDIFNTLRDALVELFEIEPERVTPEANLYTDLEIDSIDAIDLIDHVRRQTGRKLDA NDFRTVRTVEDVVQAMWQKQAPDA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcatacccgcgaggacatcttcaatacgctgcgcgatgcgctggtcgaactgttcgag atcgaacccgagcgcgtcacgccagaggccaatctgtacaccgatctggaaatcgacagc atcgacgccatcgacctgatcgaccacgtgcgccgccagaccggccgcaagctggacgcg aacgacttccgcacggtgcgaaccgtcgaggacgtggtccaggccatgtggcaaaagcag gctcccgacgcatga

DBGET integrated database retrieval system