Alkalitalea saponilacus: CDL62_01480 Help Entry CDL62_01480       CDS       T04906                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism asx  Alkalitalea saponilacus Pathway asx00020   Citrate cycle (TCA cycle) asx00720   Other carbon fixation pathways asx01100   Metabolic pathways asx01110   Biosynthesis of secondary metabolites asx01120   Microbial metabolism in diverse environments asx01200   Carbon metabolism asx01210   2-Oxocarboxylic acid metabolism Module asx_M00009   Citrate cycle (TCA cycle, Krebs cycle) asx_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:asx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CDL62_01480   09102 Energy metabolism    00720 Other carbon fixation pathways     CDL62_01480 Enzymes [BR:asx01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CDL62_01480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_16 Fer4_9 Fer4_2 Fer4_15 Fer4_4 Fer4_3 Fer4_22 Fer4_17 Fer4_13 Fer4_8 Motif Other DBs NCBI-ProteinID:  ASB47913 UniProt:  A0A1T5GAT5 LinkDB All DBs Position complement(395656..395892) Genome browser AA seq 78 aa AA seqDB search MAKVRGAIVVDTVTCKGCSLCVESCPTDVIRLAAEVNAKGYNYAYMENPEACIGCANCAM VCPDSCITVYKVKVAEAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttagaggtgcaattgtggtggatacggtaacctgcaaaggttgttctctt tgtgtagagtcttgtcccaccgatgttatccgtctggctgcggaggtaaacgcaaaagga tacaattacgcttatatggagaacccggaggcttgtatcggatgcgccaattgtgcaatg gtatgtccagatagttgtatcactgtttataaagttaaagttgctgaagctgtctga

DBGET integrated database retrieval system