KEGG   Alkalitalea saponilacus: CDL62_05690
Entry
CDL62_05690       CDS       T04906                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00770  Pantothenate and CoA biosynthesis
asx01100  Metabolic pathways
asx01240  Biosynthesis of cofactors
Module
asx_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CDL62_05690
Enzymes [BR:asx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     CDL62_05690
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig NICE-3
Other DBs
NCBI-ProteinID: ASB48669
UniProt: A0A1T5AKI8
LinkDB
Position
complement(1465190..1465681)
AA seq 163 aa
MERIAIFPGSFDPFTVGHENIVRRGLKLFDKIIIAVGYNATKSYYFSIDERVAFIKAQFE
DEPRILVERYENLTVEFADEKQADFILRGIRTAADFEYERAIAQVNKLMTGIDSVFLLTT
PEHTPVNSSIVRDILKHNGDASKFIPVITYRMIQDIRAGKVKF
NT seq 492 nt   +upstreamnt  +downstreamnt
atggaaagaatagcaattttccccggatcatttgatccctttacggttggtcacgagaac
atcgttcgtcgtgggttaaagctttttgataagataattatagcggttggttacaatgcc
acaaagagctactatttttcgattgatgaacgcgtggcgttcattaaagctcagtttgag
gacgagccacgtatattagtggaaagatatgagaatcttaccgtggagtttgctgacgaa
aaacaggccgattttatattgcgcggcatcagaactgctgccgattttgaatatgagcgt
gccattgcccaggttaataaactgatgaccggaattgattccgtgtttttattaaccacg
ccggaacacacgccagtaaattcatctattgttagagacattcttaaacacaatggtgat
gcatcaaagtttattcctgtaataacttatcgaatgattcaggatatcagagctgggaag
gttaaattttga

DBGET integrated database retrieval system