Apodemus sylvaticus (European woodmouse): 127671802
Help
Entry
127671802 CDS
T10613
Symbol
Psmd7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
asyl Apodemus sylvaticus (European woodmouse)
Pathway
asyl03050
Proteasome
asyl05010
Alzheimer disease
asyl05012
Parkinson disease
asyl05014
Amyotrophic lateral sclerosis
asyl05016
Huntington disease
asyl05017
Spinocerebellar ataxia
asyl05020
Prion disease
asyl05022
Pathways of neurodegeneration - multiple diseases
asyl05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
asyl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
127671802 (Psmd7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
127671802 (Psmd7)
09164 Neurodegenerative disease
05010 Alzheimer disease
127671802 (Psmd7)
05012 Parkinson disease
127671802 (Psmd7)
05014 Amyotrophic lateral sclerosis
127671802 (Psmd7)
05016 Huntington disease
127671802 (Psmd7)
05017 Spinocerebellar ataxia
127671802 (Psmd7)
05020 Prion disease
127671802 (Psmd7)
05022 Pathways of neurodegeneration - multiple diseases
127671802 (Psmd7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
asyl03051
]
127671802 (Psmd7)
Proteasome [BR:
asyl03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
127671802 (Psmd7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Coilin_N
Connexin
Motif
Other DBs
NCBI-GeneID:
127671802
NCBI-ProteinID:
XP_052022724
LinkDB
All DBs
Position
21:22040642..22048765
Genome browser
AA seq
320 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDAKKEEKKEKK
NT seq
963 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaagcgggtagtcggtgtgcttttg
ggatcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatggg
atgtttaagaaagtcaatgccagagaaagaatagttgggtggtaccacacaggccccaaa
ctgcacaagaacgatatcgccatcaatgaacttatgaagagatactgccccaactcggta
ttggtcattatcgacgtgaagccaaaggacctgggtcttcccaccgaagcctacatctca
gtggaggaagtgcatgacgacgggacaccaacatcaaaaacgtttgagcacgtgaccagt
gagattggcgcagaggaagctgaggaggttggagtggagcacttgctaagagacatcaag
gacactacagtggggactctctcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagctcctggacatcaggagctacctggagaaggtagccagcggcaagctg
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccggacgcc
agcctgcaggagttcgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacttggcctcgctgatccgctccgtggtcgccttgcataacctcatcaacaacaagatt
gccaaccgggatgcggagaagaaggagggacaggaaaaggaggagagcaagaaggagaga
aaagacgacaaagagaaggagaagagtgacgcaaagaaagaagagaaaaaggagaaaaag
taa
DBGET
integrated database retrieval system