KEGG   Acetobacter senegalensis: ASN_1393
Entry
ASN_1393          CDS       T04217                                 
Name
(GenBank) ABC transporter related protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
asz  Acetobacter senegalensis
Brite
KEGG Orthology (KO) [BR:asz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asz02000]
    ASN_1393
Transporters [BR:asz02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    ASN_1393
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_16 AAA_22 AAA_30 MeaB AAA_21 AAA_18 AAA_24 AAA_29 AAA ABC_ATPase AAA_33 RsgA_GTPase AAA_5 G-alpha DUF5906 DUF87 KAP_NTPase SpoIVA_ATPase
Other DBs
NCBI-ProteinID: CEF40754
UniProt: A0A0U5B8R4
LinkDB
Position
I:complement(1349100..1350899)
AA seq 599 aa
MNTPSSAAHSAARRQNLFVDVLKFVMRRWLDFPVPLWVTVAGVMVATVLDVLMPVLAGRL
VSDVAQPATQSALMRDAIWMLVGMAACGVGNVLGKRAAYLGITHLTTQVMHKIGAQAFAR
VQRLSTDWHANTFAGSTVRRLTRGMWAVDMLDDTLLLMLIPEVCLLVLTTLVLAWHWLFM
GVLLGVLSAVFITTSCLLTLRYVAPTARESNRWDSRMGAALADAITCNAVVKAFGAEKRE
EQRLEDVIGQWRKHTCLTWTRGTNSAGIQNLMVTFMRLALAGAAVWLWLKGLAGPGDVAY
VLTMTFLVQGYLRDIGQQVSVVQRSVNEMEELLELWRTEPSVKDVPTAVPFKAREGEIRF
EHVSFQYPGQKKQIFSDLNVTIKAGSRVGLVGPSGSGKSTFTKLLQRLYELDGGRITIDG
VDISTINQSSLRSEIAIVQQEPMLFHRSLADNIAYGSPDATQADIEEAARLANAADFIAR
LPEGYDTLVGERGVKLSGGERQRVAIARAFLANTPILVMDEATASLDSQSEALVQEAMQR
LMEGRTVIVIAHRLATVVDLDRILVFERGHVVEDGSHAKLVQKPDGLYHKLYELQSLEQ
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgaataccccctcttccgctgcgcattccgccgcacggaggcaaaatctgtttgtcgat
gtcctgaaatttgtcatgcgccgctggctggattttccagttccgctgtgggtgactgtg
gccggtgtcatggtggccacagtgctggatgtgctcatgcccgttctggccggacggctg
gtgtcggatgttgcgcagcccgcaacacagtctgctttgatgcgggatgccatctggatg
ctggtgggcatggcggcgtgcggcgtggggaatgtgctgggcaagcgggccgcctatctg
ggcatcacacatctgaccacgcaggtcatgcacaagattggcgcgcaggcttttgcgcgg
gtgcagcgtctctccacagactggcacgccaatacctttgcaggttctaccgtaagaagg
ctgacacgcggcatgtgggcggtggacatgctggatgataccctgctgcttatgctcatt
cctgaagtctgtctgctggtgctgaccacattggttctggcatggcactggcttttcatg
ggtgtgctgctgggcgttctgtccgcggtgttcatcaccacctcctgcctgctgaccttg
cgctacgttgcgcccacggcacgggaatccaaccggtgggacagccgcatgggggccgcg
ttggcggatgccattacctgcaatgcggtggtcaaggcctttggcgcggagaagcgtgaa
gagcagcggctggaggatgttattggccagtggcgcaaacacacctgcctgacatggaca
cgcggcaccaacagcgcgggcattcagaatctgatggtcacgttcatgcggttggctctt
gcgggggcggcagtatggttgtggctgaaagggctcgccgggccgggcgatgttgcttac
gtgctgaccatgacctttctggtgcagggctatctgcgggatatcggccagcaggtgtcc
gttgtgcagcgctccgtcaacgagatggaagaactgcttgaactgtggcgtaccgaacca
tccgtgaaagatgttcccactgctgttccgttcaaagcgcgggaaggggagatccggttc
gagcatgtcagttttcaatatccgggccagaaaaagcagattttttctgatctgaacgtc
accatcaaagcaggcagccgcgtggggctggtggggccttcaggttcgggaaaatcgacc
ttcaccaagctgttgcagcggctttatgaactggatggcgggcgtatcactattgatggg
gtggatatttccaccatcaatcagtcctctctgcggtcggaaattgccattgtgcagcag
gagcccatgctgtttcaccgcagtctggcagacaatattgcctatggcagcccggatgcc
acacaggccgatattgaagaagcagcccggctggccaatgcggcggacttcattgcccgc
ctgccggagggatatgacacgctggttggtgaacgcggcgtgaagctctcgggtggggag
cgtcagcgggtggccattgcgcgtgcgtttctggccaacacccctattctggtgatggac
gaagccacagccagccttgattctcaatcagaggcgctggtgcaggaggccatgcaacgc
ctgatggaagggcgcacggtgatcgtcattgcccatcgtcttgctactgtggttgatctg
gaccgcattctggtgtttgagcgcggtcatgtggtggaagatggttcgcacgcaaaactg
gtgcagaaaccggacggactttatcacaaactgtatgaattgcagtccctggaacagtag

DBGET integrated database retrieval system