KEGG   Acetobacter senegalensis: ASN_2871
Entry
ASN_2871          CDS       T04217                                 
Symbol
oxaA
Name
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
asz  Acetobacter senegalensis
Pathway
asz02024  Quorum sensing
asz03060  Protein export
asz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:asz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ASN_2871 (oxaA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ASN_2871 (oxaA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASN_2871 (oxaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:asz03029]
    ASN_2871 (oxaA)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:asz02044]
    ASN_2871 (oxaA)
Mitochondrial biogenesis [BR:asz03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    ASN_2871 (oxaA)
Secretion system [BR:asz02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ASN_2871 (oxaA)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP
Other DBs
NCBI-ProteinID: CEF42128
UniProt: A0A0U5EYT1
LinkDB
Position
I:2819396..2821147
AA seq 583 aa
MDTRRLILATLLSAVVLIGFDYFFPQGPKAPVPTSTQQTVSAPASGGAPSANVPAAPSVA
EPAAQPDGPETRVVIDAPAVQGSLSLRGAKLDDLVLKAYRETTDANSPDVRVLSHATQAK
PDYVDFGWRAASDATVHLPDANTLWKADNTHLDATHPVNLTWDNGQGLTFEIAMAVDKNF
MFTVTQRVHNTSGQAVALYPFYRVNRGYTPETNGGMLVHEGPISVIDGRLNEGSYKSLRK
DGVPPDNVSWSHQGTGGWAGITDKYWLMAVVPDQSAQVVGAYTYLPQKNMYQVGFTSTAP
IQIAAGQTASTEAHVFAGAKEVRLLDQYEHDLHIPMFWKAVDFGWLSFLTRPVFFVLDWL
YSMMGNFGLALLTFTVIVKLAFLPLTIKQMRMTWKTSRLKPKVDQIRARYKDDPMAMQQH
IMGLYREENVNLFGGFLPLFIQAPVFWCLYKDLYVTIEMRHAPFFGWIKDLSAPDPTNIF
NLFGLIPFNPAHVLPLLALGAWPILYGATMFLMQKISASSTNMDPAQQKVMAFIPLLFTF
FMAHQPVGLVIYYCWSNLLTALQQVLILGRFKAADKKSVPSKS
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatacaagacgtctgatactggcaacgctgctgtcagctgtggttctcatcgggttt
gattatttcttcccgcaggggccaaaggcccctgttcccacatccactcaacaaactgtt
tctgctccggcttctggcggtgctccgtcagcaaatgtgcccgcagcgccgagcgtagcg
gagcccgcggctcagccggatggccctgagacgcgtgtggtgattgatgctccggctgtg
cagggcagcctgagcctgcgcggtgccaaactggatgatctggtgctcaaggcgtaccgt
gaaacaacggatgccaacagcccggatgtaagggtgctcagccacgcaacgcaggccaag
cctgactatgtggattttggctggcgtgccgcgtctgacgcaaccgttcatctgccagat
gccaacacgctgtggaaagcagacaacacacatctggatgcgacccatcccgtaaatctt
acatgggataacggtcaggggctgacgtttgagatcgccatggcggttgacaagaacttc
atgttcacggtgacccagcgtgtgcacaacaccagtggtcaggctgtggccctgtatccc
ttctaccgtgtgaaccggggctacacgcctgaaacaaacggcggcatgctggtgcatgaa
ggtcctatttccgtcattgatggtcgtctgaacgaagggtcttacaaatccctgcgcaag
gatggggttccgccggataacgtgtcctggagccatcagggcaccggtggctgggctggt
attacggacaaatactggctgatggccgttgtgcctgatcagtccgcgcaggtggtgggc
gcttatacgtacctgccgcagaaaaacatgtatcaggtcggctttaccagcacggccccc
attcagattgcagccggccagacagccagcaccgaagcccatgtttttgccggtgccaag
gaagtgcgtctgctcgaccagtatgagcacgacctgcatatccccatgttctggaaggct
gtggatttcggctggctttccttcctgacacgtccggtcttcttcgtgctggactggctg
tattccatgatgggcaattttggtctggctctgctaacctttacggttatcgtgaagctg
gccttcctgccgctgaccatcaagcagatgcgcatgacgtggaaaaccagccgcctgaag
ccgaaggtggaccagatccgcgcgcgttacaaagatgatcccatggccatgcagcagcat
attatggggctgtatcgggaagagaacgtgaacctgtttggtggcttcctgcccctgttc
attcaggctcccgtgttctggtgtctgtataaggatctgtatgtcaccattgaaatgcgt
cacgcgccgttctttggctggatcaaggacctttccgcgccagaccccacgaatattttc
aacctgtttggtctgattccgttcaacccggcgcatgtgttgccgttgctggcgctgggc
gcgtggccgatcctgtatggcgctaccatgttcctgatgcagaagatcagcgccagttcc
accaacatggacccggcccagcagaaggtgatggcgttcattccgttgctgttcaccttc
ttcatggcgcatcagcccgtgggtttggtgatctattattgctggagcaacctgctgacg
gcattgcagcaggtgcttattctggggcggttcaaagctgcggataaaaaatccgtgccg
agcaaaagctga

DBGET integrated database retrieval system