Acetobacter senegalensis: ASN_3121 Help Entry ASN_3121          CDS       T04217                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asz  Acetobacter senegalensis Pathway asz01100   Metabolic pathways asz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASN_3121    00074 Mycolic acid biosynthesis     ASN_3121   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASN_3121 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_HaeII Motif Other DBs NCBI-ProteinID:  CEF42366 UniProt:  A0A0U4Y616 LinkDB All DBs Position I:complement(3088198..3088449) Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDTLDVSVPL DKLADIRTINDLATCIVDLKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttctgcgctgatcatccagaagcttctcgccaacccg aaggtgcctcgcgatatcgatggaaactgcaagatcatggaagatcttgcctttgattct ctggcagtcatgaactttgtcatggaagttgaagatacgttggatgtctccgttccgttg gacaagctggctgacatccgtaccatcaatgatcttgcaacctgcattgttgacctgaaa aacaaaggctga

DBGET integrated database retrieval system