Acetobacter senegalensis: ASN_3675 Help Entry ASN_3675          CDS       T04217                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asz  Acetobacter senegalensis Pathway asz01100   Metabolic pathways asz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASN_3675 (acpP)    00074 Mycolic acid biosynthesis     ASN_3675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASN_3675 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CEF42897 UniProt:  A0A0U5F3C0 LinkDB All DBs Position I:3737665..3737904 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVEESKVTPEASFIDDLGADSLDTVELVMAFEEAFNVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgataaggttaagaaaattgtggtcgagcatctcggcgtcgaggaa agcaaggtcacgccggaagcgtcgttcatcgacgatctgggagcagacagccttgatacc gttgaactcgtgatggcttttgaagaagctttcaacgttgagattccggaagacgctgct gaaaagatcgccactgtcaaagacgcgattgactacatcgaaaagcagaaagcggcctga

DBGET integrated database retrieval system