KEGG   Aethina tumida (small hive beetle): 109598486
Entry
109598486         CDS       T06105                                 
Name
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04146  Peroxisome
atd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:atd00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109598486
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109598486
Enzymes [BR:atd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109598486
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 109598486
NCBI-ProteinID: XP_019869956
LinkDB
Position
3:complement(join(10563588..10563983,10564035..10564103))
AA seq 154 aa
MPKKAVCVLNGEIVKGTLWFSQQDSSSPVEVTGEVTGLGKGLHGFHVHEFGDNTNGCISA
GAHFNPHNKDHAGPCDESRHVGDLGNIEAGDNGVAKVNIVDKVISLDGDHNIIGRTLVVH
ADPDDLGKGGHELSKSTGNAGARVACGVIGLAKI
NT seq 465 nt   +upstreamnt  +downstreamnt
atgccgaaaaaagcagtttgcgttttgaacggcgaaatcgttaagggaaccctttggttc
tcccaacaggattcgtcaagcccggttgaagtaaccggcgaagtgaccggtttgggcaaa
ggtcttcacggcttccatgttcacgaattcggcgacaacaccaacggctgcatctccgcc
ggggcacatttcaacccccacaacaaggatcatgccggtccttgcgacgaaagccgtcat
gtaggcgatttgggcaacattgaagctggagataatggcgttgccaaagtcaacattgtc
gacaaggttatttctttggatggggaccacaacatcattggtcgcactctggttgtccat
gctgatcctgatgatttgggcaaaggcggacatgaattgagcaagtccaccggtaatgct
ggcgccagggttgcctgtggtgttattggattggcaaaaatttaa

DBGET integrated database retrieval system