Aethina tumida (small hive beetle): 109607789 Help Entry 109607789         CDS       T06105                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism atd  Aethina tumida (small hive beetle) Pathway atd04814   Motor proteins Brite KEGG Orthology (KO) [BR:atd00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     109607789  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:atd03037]     109607789    04812 Cytoskeleton proteins [BR:atd04812]     109607789 Cilium and associated proteins [BR:atd03037]  Motile cilia and associated proteins   Dynein arm    109607789 Cytoskeleton proteins [BR:atd04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109607789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  109607789 NCBI-ProteinID:  XP_019879818 LinkDB All DBs Position 1:38907379..38907741 Genome browser AA seq 120 aa AA seqDB search MEKTAQEVVDQDLVEEGAFVVDDVSKIIKDAIETIIGGNGYQQSKVNNWTTAVVEACTSE LTKLMKPYKYIVTCTIMQKNGAGLHTASSCYWDNSTDGSCTVRWENKQMFCIVSVYGLSV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggaaaagaccgcacaagaggttgtggaccaggacctcgttgaggagggtgcgttcgtt gtggacgatgttagcaaaatcattaaggacgccatagagacaattataggtggaaacggt tatcaacaaagcaaggtgaacaattggacgactgcggttgtggaggcctgcacatcggag cttaccaaattaatgaaaccttataaatatatagtaacgtgcacgattatgcagaaaaat ggggctggtttgcacacggccagttcatgttactgggacaattcgaccgatggaagctgc acagttcgttgggagaacaaacagatgttttgcattgtgtctgtttacggcttgtctgtc tag

DBGET integrated database retrieval system