Aethina tumida (small hive beetle): 109608032 Help Entry 109608032         CDS       T06105                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism atd  Aethina tumida (small hive beetle) Pathway atd03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:atd00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109608032  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:atd03036]     109608032   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atd04147]     109608032 Chromosome and associated proteins [BR:atd03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109608032 Exosome [BR:atd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109608032 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109608032 NCBI-ProteinID:  XP_019880035 LinkDB All DBs Position 5:complement(8511579..8511947) Genome browser AA seq 122 aa AA seqDB search MSGRSKDSKMKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVIEYLAA EVLELAGNAARDNKKTRVIPRHLQLAIKNDEELNQLLSGVTIAQGGVLPNIQAILLPNKS DK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcagtaaagacagtaaaatgaagggaaagtcaaagtcgcgctccagccgt gccggtcttcaatttcccgttggccgtattcaccgtcttcttcgcaaaggtaattatgcc gaacgtgttggtgccggtgctccagtttatttagcagccgtaatagaatatttggcagcc gaagttctggaattggcaggcaacgctgcccgtgacaacaaaaagactcgtgtcatcccc agacatttacaattggccatcaaaaatgatgaagaattgaaccaactcttgtcgggagtt acaatcgctcaaggaggcgtattacccaacattcaagccattctcctgccaaataagagt gataagtag

DBGET integrated database retrieval system