Caldicellulosiruptor bescii: Athe_1157 Help Entry Athe_1157         CDS       T00857                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ate  Caldicellulosiruptor bescii Pathway ate01100   Metabolic pathways ate01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ate00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Athe_1157    00074 Mycolic acid biosynthesis     Athe_1157   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Athe_1157 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ACM60258 UniProt:  B9MRF4 LinkDB All DBs Position 1249445..1249681 Genome browser AA seq 78 aa AA seqDB search MNSEIFEKVKKIIADKLDIEEDKITPESSFLDDLGADSLDIVELIMELEEEFGIEIPDED AEKIRTVADAVKYIEEHQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgaacagcgaaatttttgaaaaggtaaaaaaaatcatagcagacaaacttgacattgaa gaagacaagataacacctgaatcttctttcttggatgaccttggtgcagactcactggac attgttgagcttatcatggagcttgaagaagagtttggcattgaaattccagatgaggat gcagaaaagattagaacagttgcagatgcggtaaaatatattgaagagcatcaataa

DBGET integrated database retrieval system