Allochromatium tepidum: Atep_21660 Help Entry Atep_21660        CDS       T07447                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atep  Allochromatium tepidum Pathway atep01100   Metabolic pathways atep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Atep_21660 (acpP)    00074 Mycolic acid biosynthesis     Atep_21660 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Atep_21660 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  BCU07489 UniProt:  A0ABM7QPL3 LinkDB All DBs Position complement(2318042..2318278) Genome browser AA seq 78 aa AA seqDB search MSSVEDRVRKIVVDQLGVKEEEVTPEASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVQQAIDYINAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgttgaagaccgagttcgcaaaatagtggtggaccagttgggcgtgaaggaa gaagaagtcaccccagaggcgtccttcgtcgacgatctgggagcggactcgctcgacacc gtggaactggtcatggccctcgaggaggagttcgagaccgagattccggacgaagacgcc gagaagatcaccacggtccaacaggccatcgactacatcaacgcgcaccaggcctga

DBGET integrated database retrieval system