Aquincola tertiaricarbonis: MW290_07845 Help Entry MW290_07845       CDS       T08158                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ater  Aquincola tertiaricarbonis Pathway ater00362   Benzoate degradation ater00622   Xylene degradation ater01100   Metabolic pathways ater01120   Microbial metabolism in diverse environments ater01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ater00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     MW290_07845    00622 Xylene degradation     MW290_07845    00621 Dioxin degradation     MW290_07845 Enzymes [BR:ater01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      MW290_07845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  URI05858 LinkDB All DBs Position 1:complement(1698374..1698607) Genome browser AA seq 77 aa AA seqDB search MPFIDVKILEGVLDHAQHQALMAEITEAVVRVGGEAMRPMTRCVVQEIRSGLWSVGGKPL VPPTPPTPPTPPAAHSG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcctttcatcgacgtgaagatcctcgaaggcgtgctggaccatgcccagcaccaggcc ctgatggccgagatcaccgaagccgtggtgcgggtgggtggcgaagccatgcgcccgatg acccgctgtgtggtgcaggaaatccgcagcgggctgtggagcgtgggcggcaagccgctt gtgccacccacgccacccacaccacccacaccccctgcagcccactcgggctga

DBGET integrated database retrieval system