Aquincola tertiaricarbonis: MW290_27210 Help Entry MW290_27210       CDS       T08158                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ater  Aquincola tertiaricarbonis Pathway ater01100   Metabolic pathways ater01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ater00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MW290_27210 (acpP)    00074 Mycolic acid biosynthesis     MW290_27210 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MW290_27210 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 Motif Other DBs NCBI-ProteinID:  URI09257 LinkDB All DBs Position 2:complement(2794232..2794471) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVPESDVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYAVNHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcccgtgtcaagaagatcattgccgaacaactcggcgtgcccgag tcggacgtcaccaacgaaaaggccttcgtggccgacctgggtgccgactcgctcgacacg gtcgaactggtgatggccctcgaagacgagttcggcatcgaaatccccgacgaagaggcc gagaagatcaccacggtgcagctggcgatcgactacgcggtcaatcaccagaaggcctga

DBGET integrated database retrieval system