Agrobacterium tumefaciens Ach5: Ach5_13160 Help Entry Ach5_13160        CDS       T03816                                  Symbol hfq Name (GenBank) host factor-I protein   KO K03666   host factor-I protein Organism atf  Agrobacterium tumefaciens Ach5 Pathway atf02024   Quorum sensing atf03018   RNA degradation Brite KEGG Orthology (KO) [BR:atf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Ach5_13160 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Ach5_13160 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:atf03019]     Ach5_13160 (hfq)    03036 Chromosome and associated proteins [BR:atf03036]     Ach5_13160 (hfq) Messenger RNA biogenesis [BR:atf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Ach5_13160 (hfq) Chromosome and associated proteins [BR:atf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Ach5_13160 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AKC07092 UniProt:  A0AA86KPK0 LinkDB All DBs Position circular:1355557..1355799 Genome browser AA seq 80 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPGQPMQMFESEEGAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttctcaaaaccttcaggatcttttcctcaataccgttcgtaagcaaaag atttcgctcacgattttcctgatcaacggcgtcaagctgacgggcgttgtcacttccttc gataatttctgcgtgcttctgcgccgtgacggtcactcgcagcttgtttacaagcatgcg atctccaccattatgcccggccagccgatgcagatgttcgagagcgaagaaggcgcagcc tga

DBGET integrated database retrieval system